CXorf56 (NM_022101) Human Recombinant Protein
CAT#: TP301305
Recombinant protein of human chromosome X open reading frame 56 (CXorf56), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201305 representing NM_022101
Red=Cloning site Green=Tags(s) MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCN TEDEETMYLRRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGKTNIYTQKQEPPK KVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKA KMKGTLIDNQFK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071384 |
Locus ID | 63932 |
UniProt ID | Q9H5V9 |
Cytogenetics | Xq24 |
Refseq Size | 904 |
Refseq ORF | 666 |
Synonyms | MRX107 |
Summary | While this gene is well-supported by transcript data, no functional information on its protein products is currently available. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411776 | CXorf56 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432632 | CXorf56 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411776 | Transient overexpression lysate of chromosome X open reading frame 56 (CXorf56), transcript variant 1 |
USD 436.00 |
|
LY432632 | Transient overexpression lysate of chromosome X open reading frame 56 (CXorf56), transcript variant 2 |
USD 436.00 |
|
PH301305 | CXorf56 MS Standard C13 and N15-labeled recombinant protein (NP_071384) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review