CXorf56 (NM_022101) Human Recombinant Protein

CAT#: TP301305

Recombinant protein of human chromosome X open reading frame 56 (CXorf56), 20 µg

Product Images

Coomassie blue staining of purified CXorf56 protein (Cat# TP301305). The protein was produced from HEK293T cells transfected with CXorf56 cDNA clone (Cat# RC201305) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201305 representing NM_022101
  Red=Cloning site Green=Tags(s)
  
  MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCN
  TEDEETMYLRRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGKTNIYTQKQEPPK
  KVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKA
  KMKGTLIDNQFK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071384
• Locus ID: 63932
• UniProt ID: Q9H5V9
• Cytogenetics: Xq24
• Refseq Size: 904
• Refseq ORF: 666
• Synonyms: MRX107
• Summary: While this gene is well-supported by transcript data, no functional information on its protein products is currently available. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]