DHRS3 (NM_004753) Human Recombinant Protein

CAT#: TP301180L

Recombinant protein of human dehydrogenase/reductase (SDR family) member 3 (DHRS3), 1 mg

Product Images

Coomassie blue staining of purified DHRS3 protein (Cat# TP301180). The protein was produced from HEK293T cells transfected with DHRS3 cDNA clone (Cat# RC201180) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201180 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAERGARKIVLWG
  RTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL
  LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCP
  GVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQA
  ALEEIHKFSGTYTCMNTFKGRT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004744
• Locus ID: 9249
• UniProt ID: O75911
• Cytogenetics: 1p36.21
• Refseq Size: 1741
• Refseq ORF: 906
• Synonyms: DD83.1; RDH17; retSDR1; Rsdr1; SDR1; SDR16C1
• Summary: Short-chain dehydrogenases/reductases (SDRs), such as DHRS3, catalyze the oxidation/reduction of a wide range of substrates, including retinoids and steroids (Haeseleer and Palczewski, 2000 [PubMed 10800688]).[supplied by OMIM, Jun 2009]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Metabolic pathways, Retinol metabolism