WIT1 (NM_015855) Human Recombinant Protein
CAT#: TP301018
Recombinant protein of human Wilms tumor upstream neighbor 1 (WIT1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201018 representing NM_015855
Red=Cloning site Green=Tags(s) MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQP QPQGPVRTPGPPSGSHPAAADN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056939 |
Locus ID | 51352 |
Cytogenetics | 11p13 |
Refseq Size | 1962 |
Refseq ORF | 276 |
Synonyms | WIT-1, dJ74J1.1, MGC120207, MGC120208, MGC120209 |
Summary | This gene is located upstream of the Wilms tumor 1 (WT1) gene; these two genes are bi-directionally transcribed from the same promoter region. This gene is imprinted in kidney, with preferential expression from the paternal allele. Imprinting defects at chromosome 11p13 may contribute to tumorigenesis. [provided by RefSeq, May 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414347 | WIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414347 | Transient overexpression lysate of Wilms tumor upstream neighbor 1 (WIT1) |
USD 436.00 |
|
PH301018 | WIT1 MS Standard C13 and N15-labeled recombinant protein (NP_056939) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review