WIT1 (NM_015855) Human Recombinant Protein

CAT#: TP301018

Recombinant protein of human Wilms tumor upstream neighbor 1 (WIT1), 20 µg

Product Images

Coomassie blue staining of purified WIT1 protein (Cat# TP301018). The protein was produced from HEK293T cells transfected with WIT1 cDNA clone (Cat# RC201018) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201018 representing NM_015855
  Red=Cloning site Green=Tags(s)
  
  MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQP
  QPQGPVRTPGPPSGSHPAAADN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056939
• Locus ID: 51352
• Cytogenetics: 11p13
• Refseq Size: 1962
• Refseq ORF: 276
• Synonyms: WIT-1, dJ74J1.1, MGC120207, MGC120208, MGC120209
• Summary: This gene is located upstream of the Wilms tumor 1 (WT1) gene; these two genes are bi-directionally transcribed from the same promoter region. This gene is imprinted in kidney, with preferential expression from the paternal allele. Imprinting defects at chromosome 11p13 may contribute to tumorigenesis. [provided by RefSeq, May 2014]
• Protein Families: Druggable Genome