GRHPR (NM_012203) Human Recombinant Protein

CAT#: TP300963M

Recombinant protein of human glyoxylate reductase/hydroxypyruvate reductase (GRHPR), 100 µg

Product Images

Coomassie blue staining of purified GRHPR protein (Cat# TP300963). The protein was produced from HEK293T cells transfected with GRHPR cDNA clone (Cat# RC200963) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200963 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDA
  AGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTS
  WKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSD
  FIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNH
  PLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036335
• Locus ID: 9380
• UniProt ID: Q9UBQ7, A0A384N605
• Cytogenetics: 9p13.2
• Refseq Size: 1235
• Refseq ORF: 984
• Synonyms: GLXR; GLYD; PH2
• Summary: This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Pyruvate metabolism