GRHPR (NM_012203) Human Tagged ORF Clone

CAT#: RC200963

GRHPR (Myc-DDK-tagged)-Human glyoxylate reductase/hydroxypyruvate reductase (GRHPR)

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 470.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name GRHPR (NM_012203) Human Tagged ORF Clone
Symbol GRHPR
Synonyms GLXR; GLYD; PH2
Vector pCMV6-Entry
Sequence Data
>RC200963 representing NM_012203
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGACCGGTGCGACTCATGAAGGTGTTCGTCACCCGCAGGATACCCGCCGAGGGTAGGGTCGCGCTCG
CCCGGGCGGCAGACTGTGAGGTGGAGCAGTGGGACTCGGATGAGCCCATCCCTGCCAAGGAGCTAGAGCG
AGGTGTGGCGGGGGCCCACGGCCTGCTCTGCCTCCTCTCCGACCACGTGGACAAGAGGATCCTGGATGCT
GCAGGGGCCAATCTCAAAGTCATCAGCACCATGTCTGTGGGCATCGACCACTTGGCTTTGGATGAAATCA
AGAAGCGTGGGATCCGAGTTGGCTACACCCCAGATGTCCTGACAGATACCACCGCCGAACTCGCAGTCTC
CCTGCTACTTACCACCTGCCGCCGGTTGCCGGAGGCCATCGAGGAAGTGAAGAATGGTGGCTGGACCTCG
TGGAAGCCCCTCTGGCTGTGTGGCTATGGACTCACGCAGAGCACTGTCGGCATCATCGGGCTGGGGCGCA
TAGGCCAGGCCATTGCTCGGCGTCTGAAACCATTCGGTGTCCAGAGATTTCTGTACACAGGGCGCCAGCC
CAGGCCTGAGGAAGCAGCGGAATTCCAGGCAGAGTTTGTGTCTACCCCTGAGCTGGCTGCCCAATCTGAT
TTCATCGTCGTGGCCTGCTCCTTAACACCTGCAACCGAGGGACTCTGCAACAAGGACTTCTTCCAGAAGA
TGAAGGAAACAGCTGTGTTCATCAACATCAGCAGGGGCGACGTCGTAAACCAGGACGACCTGTACCAGGC
CTTGGCCAGTGGTAAGATTGCAGCTGCTGGACTGGATGTGACGAGCCCAGAACCACTGCCTACAAACCAC
CCTCTCCTGACCCTGAAGAACTGTGTGATTCTGCCCCACATTGGCAGTGCCACCCACAGAACCCGCAACA
CCATGTCCTTGTTGGCAGCTAACAACTTGCTGGCTGGCCTGAGAGGGGAGCCGATGCCTAGTGAACTCAA
GCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200963 representing NM_012203
Red=Cloning site Green=Tags(s)

MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDA
AGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTS
WKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSD
FIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNH
PLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012203
ORF Size 984 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012203.1, NP_036335
RefSeq Size 1235
RefSeq ORF 987
Locus ID 9380
Cytogenetics 9p13.2
Domains 2-Hacid_DH, 2-Hacid_DH_C
Protein Families Druggable Genome
Protein Pathways Pyruvate metabolism, Glyoxylate and dicarboxylate metabolism, Metabolic pathways
MW 35.5 kDa
Gene Summary This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)