EFHD1 (NM_025202) Human Recombinant Protein

CAT#: TP300956M

Recombinant protein of human EF-hand domain family, member D1 (EFHD1), 100 µg

Product Images

Coomassie blue staining of purified EFHD1 protein (Cat# TP300956). The protein was produced from HEK293T cells transfected with EFHD1 cDNA clone (Cat# RC200956) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200956 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAA
  RPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDE
  DFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELK
  AEQDERKREEEERRLRQAAFQKLKANFNT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079478
• Locus ID: 80303
• UniProt ID: Q9BUP0
• Cytogenetics: 2q37.1
• Refseq Size: 2000
• Refseq ORF: 717
• Synonyms: MST133; MSTP133; PP3051; SWS2
• Summary: This gene encodes a member of the EF-hand super family of calcium binding proteins, which are involved in a variety of cellular processes including mitosis, synaptic transmission, and cytoskeletal rearrangement. The protein encoded by this gene is composed of an N-terminal disordered region, proline-rich elements, two EF-hands, and a C-terminal coiled-coil domain. This protein has been shown to associate with the mitochondrial inner membrane, and in HeLa cells, acts as a novel mitochondrial calcium ion sensor for mitochondrial flash activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]