PAFAH2 (NM_000437) Human Recombinant Protein

CAT#: TP300355L

Recombinant protein of human platelet-activating factor acetylhydrolase 2, 40kDa (PAFAH2), 1 mg

Product Images

Coomassie blue staining of purified PAFAH2 protein (Cat# TP300355). The protein was produced from HEK293T cells transfected with PAFAH2 cDNA clone (Cat# RC200355) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200355 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNK
  RCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRS
  AATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFN
  ILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFI
  NTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMV
  RAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000428
• Locus ID: 5051
• UniProt ID: Q99487
• Cytogenetics: 1p36.11
• Refseq Size: 3581
• Refseq ORF: 1176
• Synonyms: HSD-PLA2
• Summary: This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Ether lipid metabolism, Metabolic pathways