TXNL4A (NM_006701) Human Recombinant Protein

CAT#: TP300266L

Recombinant protein of human thioredoxin-like 4A (TXNL4A), 1 mg

Product Images

Coomassie blue staining of purified TXNL4A protein (Cat# TP300266). The protein was produced from HEK293T cells transfected with TXNL4A cDNA clone (Cat# RC200266) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200266 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFN
  KMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKY
  RY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006692
• Locus ID: 10907
• UniProt ID: P83876
• Cytogenetics: 18q23
• Refseq Size: 1415
• Refseq ORF: 426
• Synonyms: BMKS; DIB1; DIM1; SNRNP15; TXNL4; U5-15kD
• Summary: The protein encoded by this gene is a member of the U5 small ribonucleoprotein particle (snRNP), and is involved in pre-mRNA splicing. This protein contains a thioredoxin-like fold and it is expected to interact with multiple proteins. Protein-protein interactions have been observed with the polyglutamine tract-binding protein 1 (PQBP1). Mutations in both the coding region and promoter region of this gene have been associated with Burn-McKeown syndrome, which is a rare disorder characterized by craniofacial dysmorphisms, cardiac defects, hearing loss, and bilateral choanal atresia. A pseudogene of this gene is found on chromosome 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]
• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome