TOLLIP (NM_019009) Human Recombinant Protein

CAT#: TP300227L

Recombinant protein of human toll interacting protein (TOLLIP), 1 mg

Product Images

Coomassie blue staining of purified TOLLIP protein (Cat# TP300227). The protein was produced from HEK293T cells transfected with TOLLIP cDNA clone (Cat# RC200227) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200227 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGM
  TRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPE
  SLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCS
  PGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061882
• Locus ID: 54472
• UniProt ID: Q9H0E2, Q6FIE9
• Cytogenetics: 11p15.5
• Refseq Size: 3665
• Refseq ORF: 822
• Synonyms: IL-1RAcPIP
• Summary: This gene encodes a ubiquitin-binding protein that interacts with several Toll-like receptor (TLR) signaling cascade components. The encoded protein regulates inflammatory signaling and is involved in interleukin-1 receptor trafficking and in the turnover of IL1R-associated kinase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]
• Protein Families: Druggable Genome
• Protein Pathways: Toll-like receptor signaling pathway