TMCO1 (NM_019026) Human Recombinant Protein

CAT#: TP300219L

Recombinant protein of human transmembrane and coiled-coil domains 1 (TMCO1), 1 mg

Product Images

Coomassie blue staining of purified TMCO1 protein (Cat# TP300219). The protein was produced from HEK293T cells transfected with TMCO1 cDNA clone (Cat# RC200219) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200219 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIE
  RQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTD
  CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061899
• Locus ID: 54499
• UniProt ID: Q9UM00
• Cytogenetics: 1q24.1
• Refseq Size: 4478
• Refseq ORF: 564
• Synonyms: HP10122; PCIA3; PNAS-136; TMCC4
• Summary: This locus encodes a transmembrane protein. Mutations at this locus have been associated with craniofacial dysmorphism, skeletal anomalies, and cognitive disability. Mutations at this locus have also been associated with open angle glaucoma blindness. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2012]
• Protein Families: Transmembrane