RABL4 (IFT27) (NM_006860) Human Recombinant Protein

CAT#: TP300215M

Recombinant protein of human RAB, member of RAS oncogene family-like 4 (RABL4), 100 µg

Product Images

Coomassie blue staining of purified IFT27 protein (Cat# TP300215). The protein was produced from HEK293T cells transfected with IFT27 cDNA clone (Cat# RC200215) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200215 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL
  FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA
  WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006851
• Locus ID: 11020
• UniProt ID: Q9BW83
• Cytogenetics: 22q12.3
• Refseq Size: 1101
• Refseq ORF: 558
• Synonyms: BBS19; FAP156; RABL4; RAYL
• Summary: This gene encodes a GTP-binding protein that is a core component of the intraflagellar transport complex B. Characterization of the similar Chlamydomonas protein indicates a function in cell cycle control. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome