CFAP298 (NM_021254) Human Recombinant Protein

CAT#: TP300169

Recombinant protein of human chromosome 21 open reading frame 59 (C21orf59), 20 µg

Product Images

Coomassie blue staining of purified CFAP298 protein (Cat# TP300169). The protein was produced from HEK293T cells transfected with CFAP298 cDNA clone (Cat# RC200169) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200169 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQI
  EELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVK
  DALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGK
  NEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFH
  GVKDIKWRPR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067077
• Locus ID: 56683
• UniProt ID: P57076
• Cytogenetics: 21q22.11
• Refseq Size: 1427
• Refseq ORF: 870
• Synonyms: C21orf48; C21orf59; CILD26; FBB18; Kur
• Summary: This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene. [provided by RefSeq, Apr 2017]