KLHDC2 (NM_014315) Human Recombinant Protein

CAT#: TP300116M

Recombinant protein of human kelch domain containing 2 (KLHDC2), 100 µg

Product Images

Coomassie blue staining of purified KLHDC2 protein (Cat# TP300116). The protein was produced from HEK293T cells transfected with KLHDC2 cDNA clone (Cat# RC200116) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200116 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADGNEDLRADDLPGPAFESYESMELACPAERSGHVAVSDGRHMFVWGGYKSNQVRGLYDFYLPREELWI
  YNMETGRWKKINTEGDVPPSMSGSCAVCVDRVLYLFGGHHSRGNTNKFYMLDSRSTDRVLQWERIDCQGI
  PPSSKDKLGVWVYKNKLIFFGGYGYLPEDKVLGTFEFDETSFWNSSHPRGWNDHVHILDTETFTWSQPIT
  TGKAPSPRAAHACATVGNRGFVFGGRYRDARMNDLHYLNLDTWEWNELIPQGICPVGRSWHSLTPVSSDH
  LFLFGGFTTDKQPLSDAWTYCISKNEWIQFNHPYTEKPRLWHTACASDEGEVIVFGGCANNLLVHHRAAH
  SNEILIFSVQPKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055130
• Locus ID: 23588
• UniProt ID: Q9Y2U9
• Cytogenetics: 14q21.3
• Refseq Size: 1808
• Refseq ORF: 1218
• Synonyms: HCLP-1; HCLP1; LCP
• Summary: Represses CREB3-mediated transcription by interfering with CREB3-DNA binding.[UniProtKB/Swiss-Prot Function]