NTAL (LAT2) (NM_032463) Human Recombinant Protein

CAT#: TP300102L

Recombinant protein of human linker for activation of T cells family, member 2 (LAT2), transcript variant 2, 1 mg

Product Images

Coomassie blue staining of purified LAT2 protein (Cat# TP300102). The protein was produced from HEK293T cells transfected with LAT2 cDNA clone (Cat# RC200102) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200102 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSGTELLWPGAALLVLLGVAASLCVRCSRPGAKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLA
  DMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVL
  ICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMG
  QLQREASPGPVGSPDEEDGEPDYVNGEVAATEA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115852
• Locus ID: 7462
• UniProt ID: Q9GZY6
• Cytogenetics: 7q11.23
• Refseq Size: 2129
• Refseq ORF: 729
• Synonyms: HSPC046; LAB; NTAL; WBSCR5; WBSCR15; WSCR5
• Summary: This gene is one of the contiguous genes at 7q11.23 commonly deleted in Williams syndrome, a multisystem developmental disorder. This gene consists of at least 14 exons, and its alternative splicing generates 3 transcript variants, all encoding the same protein. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane