ALS2CR1 (NIF3L1) (NM_001136039) Human Mass Spec Standard

CAT#: PH327762

NIF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001129511)

Product Images

Coomassie blue staining of purified NIF3L1 protein (Cat# TP327762). The protein was produced from HEK293T cells transfected with NIF3L1 cDNA clone (Cat# RC227762) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227762
• Predicted MW: 42 kDa
• Protein Sequence:
  Sequence Link

  >RC227762 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLT
  NDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENRVGIYSPHTAYDAAPQGVNNW
  LAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEEQTRIN
  LNCTQKALMQVVDFLSRNKQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRL
  ALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL
  RDMLDSHLENKINIILSETDRDPLQVV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001129511
• RefSeq Size: 1497
• RefSeq ORF: 1131
• Synonyms: ALS2CR1; CALS-7; MDS015
• Locus ID: 60491
• UniProt ID: Q9GZT8, A0A024R3V7
• Cytogenetics: 2q33.1
• Summary: May function as a transcriptional corepressor through its interaction with COPS2, negatively regulating the expression of genes involved in neuronal differentiation.[UniProtKB/Swiss-Prot Function]