ALS2CR1 (NIF3L1) (NM_001136039) Human Recombinant Protein

CAT#: TP327762

Recombinant protein of human NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified NIF3L1 protein (Cat# TP327762). The protein was produced from HEK293T cells transfected with NIF3L1 cDNA clone (Cat# RC227762) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC227762 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLT
  NDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENRVGIYSPHTAYDAAPQGVNNW
  LAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEEQTRIN
  LNCTQKALMQVVDFLSRNKQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRL
  ALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL
  RDMLDSHLENKINIILSETDRDPLQVV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001129511
• Locus ID: 60491
• UniProt ID: Q9GZT8, A0A024R3V7
• Cytogenetics: 2q33.1
• Refseq Size: 1497
• Refseq ORF: 1131
• Synonyms: ALS2CR1; CALS-7; MDS015
• Summary: May function as a transcriptional corepressor through its interaction with COPS2, negatively regulating the expression of genes involved in neuronal differentiation.[UniProtKB/Swiss-Prot Function]