Troponin I fast skeletal muscle (TNNI2) (NM_001145829) Human Mass Spec Standard

CAT#: PH327419

TNNI2 MS Standard C13 and N15-labeled recombinant protein (NP_001139301)

Product Images

Coomassie blue staining of purified TNNI2 protein (Cat# TP327419). The protein was produced from HEK293T cells transfected with TNNI2 cDNA clone (Cat# RC227419) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227419
• Predicted MW: 21.3 kDa
• Protein Sequence:
  Sequence Link

  >RC227419 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHA
  KIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRAN
  LKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001139301
• RefSeq Size: 746
• RefSeq ORF: 546
• Synonyms: AMCD2B; DA2B; DA2B1; FSSV; fsTnI
• Locus ID: 7136
• UniProt ID: P48788
• Cytogenetics: 11p15.5
• Summary: This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009]