C5orf24 (NM_001135586) Human Mass Spec Standard
CAT#: PH326792
C5orf24 MS Standard C13 and N15-labeled recombinant protein (NP_001129058)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226792 |
Predicted MW | 20.1 kDa |
Protein Sequence |
>RC226792 protein sequence
Red=Cloning site Green=Tags(s) MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGR SIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGR PPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001129058 |
RefSeq Size | 5083 |
RefSeq ORF | 564 |
Locus ID | 134553 |
UniProt ID | Q7Z6I8 |
Cytogenetics | 5q31.1 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407577 | C5orf24 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427625 | C5orf24 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407577 | Transient overexpression lysate of chromosome 5 open reading frame 24 (C5orf24), transcript variant 2 |
USD 436.00 |
|
LY427625 | Transient overexpression lysate of chromosome 5 open reading frame 24 (C5orf24), transcript variant 1 |
USD 436.00 |
|
PH308835 | C5orf24 MS Standard C13 and N15-labeled recombinant protein (NP_689622) |
USD 3,255.00 |
|
TP308835 | Recombinant protein of human chromosome 5 open reading frame 24 (C5orf24), transcript variant 2, 20 µg |
USD 867.00 |
|
TP326792 | Recombinant protein of human chromosome 5 open reading frame 24 (C5orf24), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review