NUDT19 (NM_001105570) Human Mass Spec Standard

CAT#: PH325574

NUDT19 MS Standard C13 and N15-labeled recombinant protein (NP_001099040)

Product Images

Coomassie blue staining of purified NUDT19 protein (Cat# TP325574). The protein was produced from HEK293T cells transfected with NUDT19 cDNA clone (Cat# RC225574) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225574
• Predicted MW: 42.1 kDa
• Protein Sequence:
  Sequence Link

  >RC225574 representing NM_001105570
  Red=Cloning site Green=Tags(s)
  
  MSSSLRPGPSRWRRAASIVLAAGWSRPETATPPSRPPPAEGFRLLLLQRSPHQGFMPGAHVFSGGVLDAA
  DRSADWLGLFAPHHGPPRFGLGPAPFSRTAFPSLPDTDDHKTDNTGTLPEDVAFRICAVREAFEEAGVLL
  LRPRTSPPGPAPGPGLALEPPPGLASWRDRVRQDPRHFLRLCAHLDCTPDIWALHNWSAWLTPFLRGTTR
  RFDTAFFLCCLREPPPVYPDLAEVVGYQWSSPSEATESFLSKEIWLPPPQFYEVRRLANFASLSDLHKFC
  LGRALEGLERWLPIILLTADGMVHLLPGDELYLEDSDFLENLMSTEKKTEEIMKEGKQFHRIVTYHRHLY
  DIHVTVQPKYKHVYPKNSVVRKSHL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001099040
• RefSeq ORF: 1125
• Synonyms: RP2
• Locus ID: 390916
• UniProt ID: A8MXV4
• Cytogenetics: 19q13.11
• Summary: Coenzyme A diphosphatase that mediates the hydrolysis of a wide range of CoA esters, including choloyl-CoA and branched-chain fatty-acyl-CoA esters. At low substrate concentrations medium and long-chain fatty-acyl-CoA esters are the primary substrates (By similarity).[UniProtKB/Swiss-Prot Function]