CAB39 (NM_001130849) Human Mass Spec Standard

CAT#: PH325504

CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124321)

Product Images

Coomassie blue staining of purified CAB39 protein (Cat# TP325504). The protein was produced from HEK293T cells transfected with CAB39 cDNA clone (Cat# RC225504) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225504
• Predicted MW: 39.9 kDa
• Protein Sequence:
  Sequence Link

  >RC225504 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQL
  AQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIA
  LNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRF
  FSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKV
  FVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001124321
• RefSeq Size: 3968
• RefSeq ORF: 1023
• Synonyms: CGI-66; MO25
• Locus ID: 51719
• UniProt ID: Q9Y376, A0A024R496
• Cytogenetics: 2q37.1
• Summary: Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: mTOR signaling pathway