ABIN3 (TNIP3) (NM_001128843) Human Mass Spec Standard

CAT#: PH325469

TNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001122315)

Product Images

Coomassie blue staining of purified TNIP3 protein (Cat# TP325469). The protein was produced from HEK293T cells transfected with TNIP3 cDNA clone (Cat# RC225469) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225469
• Predicted MW: 39 kDa
• Protein Sequence:
  Sequence Link

  >RC225469 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAHFVQGTSRMIAAESSTEHKECAEPSTRKNLMNSLEQKIRCLEKQRKELLEVNQQWDQQFRSMKELYER
  KVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRHRDLTRDRLQREEKEKERLNEELHELKEENKL
  LKGKNTLANKEKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEED
  FKKERSDRERLNQEKEELQQINETSQSQLNRLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPW
  VPTGPGAVQKQREHPPDYQWYALDQLPPDVQHKANGLSSVKKVHP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001122315
• RefSeq Size: 2410
• RefSeq ORF: 975
• Synonyms: ABIN-3; LIND
• Locus ID: 79931
• UniProt ID: Q96KP6, Q96KP6-2
• Cytogenetics: 4q27
• Summary: Binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expression in response to lipopolysaccharide at a level downstream of TRAF6 and upstream of IKBKB. NF-kappa-B inhibition is independent of TNFAIP3 binding.[UniProtKB/Swiss-Prot Function]