ABIN3 (TNIP3) (NM_001128843) Human Mass Spec Standard
CAT#: PH325469
TNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001122315)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225469 |
Predicted MW | 39 kDa |
Protein Sequence |
>RC225469 protein sequence
Red=Cloning site Green=Tags(s) MAHFVQGTSRMIAAESSTEHKECAEPSTRKNLMNSLEQKIRCLEKQRKELLEVNQQWDQQFRSMKELYER KVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRHRDLTRDRLQREEKEKERLNEELHELKEENKL LKGKNTLANKEKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEED FKKERSDRERLNQEKEELQQINETSQSQLNRLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPW VPTGPGAVQKQREHPPDYQWYALDQLPPDVQHKANGLSSVKKVHP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001122315 |
RefSeq Size | 2410 |
RefSeq ORF | 975 |
Synonyms | ABIN-3; LIND |
Locus ID | 79931 |
UniProt ID | Q96KP6, Q96KP6-2 |
Cytogenetics | 4q27 |
Summary | Binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expression in response to lipopolysaccharide at a level downstream of TRAF6 and upstream of IKBKB. NF-kappa-B inhibition is independent of TNFAIP3 binding.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403041 | TNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427001 | TNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403041 | Transient overexpression lysate of TNFAIP3 interacting protein 3 (TNIP3), transcript variant 1 |
USD 436.00 |
|
LY427001 | Transient overexpression lysate of TNFAIP3 interacting protein 3 (TNIP3), transcript variant 2 |
USD 436.00 |
|
TP325469 | Purified recombinant protein of Homo sapiens TNFAIP3 interacting protein 3 (TNIP3), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review