CLEC2A (NM_001130711) Human Mass Spec Standard
CAT#: PH325182
CLEC2A MS Standard C13 and N15-labeled recombinant protein (NP_001124183)
Frequently bought together (1)
Other products for "CLEC2A"
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225182 |
Predicted MW | 19.8 kDa |
Protein Sequence |
>RC225182 representing NM_001130711
Red=Cloning site Green=Tags(s) MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCF YFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEI IGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001124183 |
RefSeq ORF | 522 |
Synonyms | INPE5792; KACL; PILAR; UNQ5792 |
Locus ID | 387836 |
UniProt ID | Q6UVW9 |
Cytogenetics | 12p13.31 |
Summary | CLEC2A belongs to the CLEC2 family of activation-induced, natural killer gene complex-encoded C-type lectin-like receptors (Spreu et al., 2007 [PubMed 18046548]).[supplied by OMIM, May 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP325182 | Purified recombinant protein of Homo sapiens C-type lectin domain family 2, member A (CLEC2A), 20 µg |
USD 867.00 |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.