IL36 gamma (IL36G) (NM_019618) Human Mass Spec Standard
CAT#: PH324784
IL1F9 MS Standard C13 and N15-labeled recombinant protein (NP_062564)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224784 |
Predicted MW | 18.7 kDa |
Protein Sequence |
>RC224784 protein sequence
Red=Cloning site Green=Tags(s) MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQG RGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFI ASSKRDQPIILTSELGKSYNTAFELNIND myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_062564 |
RefSeq Size | 1212 |
RefSeq ORF | 507 |
Synonyms | IL-1F9; IL-1H1; IL-1RP2; IL1E; IL1F9; IL1H1; IL1RP2 |
Locus ID | 56300 |
UniProt ID | Q9NZH8 |
Cytogenetics | 2q14.1 |
Summary | The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, May 2019] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412705 | IL36G HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412705 | Transient overexpression lysate of interleukin 1 family, member 9 (IL1F9) |
USD 436.00 |
|
TP324784 | Recombinant protein of human interleukin 1 family, member 9 (IL1F9), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review