OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BHLHE23 (NM_080606) Human Mass Spec Standard

Be the first to review this product
SKU
PH324722
BHLHE23 MS Standard C13 and N15-labeled recombinant protein (NP_542173)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409150 Transient overexpression lysate of basic helix-loop-helix family, member e23 (BHLHE23) (as WB positive control) 100 ug
$436.00

Other products for "BHLHE23 or NM_080606"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224722
Predicted MW 23.5 kDa
Protein Sequence
Protein Sequence
>RC224722 representing NM_080606
Red=Cloning site Green=Tags(s)

MAELKSLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGGDLPAAPAPRAPAQAAESSGEQSG
DEDDAFEQRRRRRGPGSAADGRRRPREQRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSK
IATLLLAKNYILMQAQALDEMRRLVAFLNQGQGLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAF
SGTPSALCKHCHEKP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542173
RefSeq Size 942
RefSeq ORF 675
Synonyms bA305P22.3; Beta3b; BETA4; BHLHB4
Locus ID 128408
UniProt ID Q8NDY6
Cytogenetics 20q13.33
Summary This gene encodes a member of the basic helix-loop-helix transcription factor family. Members of this family contain two highly conserved and functionally distinct domains: the basic domain targets sequence-specific DNA binding, while the helix-loop-helix domain facilitates protein interaction. Studies of a related gene in mouse suggest that the encoded protein may function as a transcriptional repressor in the pancreas and brain, and that it is required for normal retinal function. provided by RefSeq, May 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BHLHE23" proteins (3)
SKU Description Size Price
LC409150 Lyophilized BHLHE23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409150 Transient overexpression lysate of basic helix-loop-helix family, member e23 (BHLHE23) (as WB positive control) 100 ug
$436.00
TP324722 Recombinant protein of human basic helix-loop-helix family, member e23 (BHLHE23), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products