BHLHE23 (NM_080606) Human Mass Spec Standard
CAT#: PH324722
BHLHE23 MS Standard C13 and N15-labeled recombinant protein (NP_542173)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224722 |
Predicted MW | 23.5 kDa |
Protein Sequence |
>RC224722 representing NM_080606
Red=Cloning site Green=Tags(s) MAELKSLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGGDLPAAPAPRAPAQAAESSGEQSG DEDDAFEQRRRRRGPGSAADGRRRPREQRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSK IATLLLAKNYILMQAQALDEMRRLVAFLNQGQGLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAF SGTPSALCKHCHEKP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_542173 |
RefSeq Size | 942 |
RefSeq ORF | 675 |
Synonyms | bA305P22.3; Beta3b; BETA4; BHLHB4 |
Locus ID | 128408 |
UniProt ID | Q8NDY6, A0A087WXG3 |
Cytogenetics | 20q13.33 |
Summary | This gene encodes a member of the basic helix-loop-helix transcription factor family. Members of this family contain two highly conserved and functionally distinct domains: the basic domain targets sequence-specific DNA binding, while the helix-loop-helix domain facilitates protein interaction. Studies of a related gene in mouse suggest that the encoded protein may function as a transcriptional repressor in the pancreas and brain, and that it is required for normal retinal function. [provided by RefSeq, May 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409150 | BHLHE23 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409150 | Transient overexpression lysate of basic helix-loop-helix family, member e23 (BHLHE23) |
USD 436.00 |
|
TP324722 | Recombinant protein of human basic helix-loop-helix family, member e23 (BHLHE23), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review