HOMER2 (NM_199330) Human Mass Spec Standard
CAT#: PH323154
HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955362)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223154 |
Predicted MW | 40.4 kDa |
Protein Sequence |
>RC223154 representing NM_199330
Red=Cloning site Green=Tags(s) MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQESGRETPSSTQ ASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQ WKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQL MSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKL GTDN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_955362 |
RefSeq Size | 2005 |
RefSeq ORF | 1062 |
Synonyms | ACPD; CPD; DFNA68; HOMER-2; VESL-2 |
Locus ID | 9455 |
UniProt ID | Q9NSB8 |
Cytogenetics | 15q25.2 |
Summary | This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein is a postsynaptic density scaffolding protein. Alternative splicing results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 14. [provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401516 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404625 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404626 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404627 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401516 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 1 |
USD 436.00 |
|
LY404625 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 2 |
USD 436.00 |
|
LY404626 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 3 |
USD 436.00 |
|
LY404627 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 4 |
USD 436.00 |
|
PH304165 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_004830) |
USD 3,255.00 |
|
PH314311 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955363) |
USD 3,255.00 |
|
PH318155 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955364) |
USD 3,255.00 |
|
TP304165 | Recombinant protein of human homer homolog 2 (Drosophila) (HOMER2), transcript variant 1, 20 µg |
USD 867.00 |
|
TP314311 | Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 3, 20 µg |
USD 867.00 |
|
TP318155 | Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 4, 20 µg |
USD 867.00 |
|
TP323154 | Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review