UNG (NM_080911) Human Mass Spec Standard
CAT#: PH322868
UNG MS Standard C13 and N15-labeled recombinant protein (NP_550433)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222868 |
Predicted MW | 34.5 kDa |
Protein Sequence |
>RC222868 representing NM_080911
Red=Cloning site Green=Tags(s) MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQ LDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSP LSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_550433 |
RefSeq Size | 2053 |
RefSeq ORF | 939 |
Synonyms | DGU; HIGM4; HIGM5; UDG; UNG1; UNG2; UNG15 |
Locus ID | 7374 |
UniProt ID | P13051, E5KTA5 |
Cytogenetics | 12q24.11 |
Summary | This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Base excision repair, Primary immunodeficiency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408998 | UNG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418736 | UNG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408998 | Transient overexpression lysate of uracil-DNA glycosylase (UNG), transcript variant 2 |
USD 436.00 |
|
LY418736 | Transient overexpression lysate of uracil-DNA glycosylase (UNG), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
TP322868 | Recombinant protein of human uracil-DNA glycosylase (UNG), transcript variant 2, 20 µg |
USD 867.00 |
|
TP760178 | Recombinant protein of human uracil-DNA glycosylase (UNG), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review