CHTF8 (NM_001040146) Human Mass Spec Standard

CAT#: PH322808

CHTF8 MS Standard C13 and N15-labeled recombinant protein (NP_001035236)

Product Images

Coomassie blue staining of purified CHTF8 protein (Cat# TP322808). The protein was produced from HEK293T cells transfected with CHTF8 cDNA clone (Cat# RC222808) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222808
• Predicted MW: 13.3 kDa
• Protein Sequence:
  Sequence Link

  >RC222808 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPF
  AVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035236
• RefSeq Size: 2907
• RefSeq ORF: 363
• Synonyms: CTF8; DERPC
• Locus ID: 54921
• UniProt ID: P0CG13
• Cytogenetics: 16q22.1
• Summary: This gene encodes a short protein that forms part of the Ctf18 replication factor C (RFC) complex that occurs in both yeast and mammals. The heteroheptameric RFC complex plays a role in sister chromatid cohesion and may load the replication clamp PCNA (proliferating cell nuclear antigen) onto DNA during DNA replication and repair. This gene is ubiquitously expressed and has been shown to have reduced expression in renal and prostate tumors. Alternatively spliced transcript variants have been described. This gene has a pseudogene on chromosome X. [provided by RefSeq, Oct 2018]