RHOF (NM_019034) Human Mass Spec Standard

CAT#: PH322772

RHOF MS Standard C13 and N15-labeled recombinant protein (NP_061907)

Product Images

Coomassie blue staining of purified RHOF protein (Cat# TP322772). The protein was produced from HEK293T cells transfected with RHOF cDNA clone (Cat# RC222772) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222772
• Predicted MW: 23.4 kDa
• Protein Sequence:
  Sequence Link

  >RC222772 representing NM_019034
  Red=Cloning site Green=Tags(s)
  
  MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLN
  LYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKE
  QLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKRRLCLL
  L
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061907
• RefSeq Size: 2451
• RefSeq ORF: 633
• Synonyms: ARHF; RIF
• Locus ID: 54509
• UniProt ID: Q9HBH0
• Cytogenetics: 12q24.31
• Summary: Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Causes the formation of thin, actin-rich surface projections called filopodia. Functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin-based morphology.[UniProtKB/Swiss-Prot Function]