LCE3C (NM_178434) Human Mass Spec Standard

CAT#: PH321967

LCE3C MS Standard C13 and N15-labeled recombinant protein (NP_848521)

Product Images

Coomassie blue staining of purified LCE3C protein (Cat# TP321967). The protein was produced from HEK293T cells transfected with LCE3C cDNA clone (Cat# RC221967) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221967
• Predicted MW: 9.7 kDa
• Protein Sequence:
  Sequence Link

  >RC221967 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRS
  NSCDRGSGQQGGGSCRGHGSGGCC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_848521
• RefSeq Size: 425
• RefSeq ORF: 282
• Synonyms: LEP15; SPRL3A
• Locus ID: 353144
• UniProt ID: Q5T5A8
• Cytogenetics: 1q21.3
• Summary: A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to bacterial antigens (PubMed:28634035).[UniProtKB/Swiss-Prot Function]