Midkine (MDK) (NM_001012334) Human Mass Spec Standard
CAT#: PH321818
MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012334)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221818 |
Predicted MW | 15.6 kDa |
Protein Sequence |
>RC221818 protein sequence
Red=Cloning site Green=Tags(s) MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK GKD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001012334 |
RefSeq Size | 1015 |
RefSeq ORF | 429 |
Synonyms | ARAP; MK; NEGF2 |
Locus ID | 4192 |
UniProt ID | P21741 |
Cytogenetics | 11p11.2 |
Summary | This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419358 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423327 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423328 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425316 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419358 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3 |
USD 436.00 |
|
LY423327 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2 |
USD 436.00 |
|
LY423328 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1 |
USD 436.00 |
|
LY425316 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1 |
USD 436.00 |
|
PH303995 | MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012333) |
USD 3,255.00 |
|
PH313133 | MDK MS Standard C13 and N15-labeled recombinant protein (NP_002382) |
USD 3,255.00 |
|
TP303995 | Recombinant protein of human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2, 20 µg |
USD 867.00 |
|
TP313133 | Recombinant protein of human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3, 20 µg |
USD 867.00 |
|
TP321818 | Purified recombinant protein of Homo sapiens midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review