PACAP (ADCYAP1) (NM_001099733) Human Mass Spec Standard
CAT#: PH321298
ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001093203)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221298 |
Predicted MW | 18.8 kDa |
Protein Sequence |
>RC221298 protein sequence
Red=Cloning site Green=Tags(s) MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001093203 |
RefSeq Size | 3187 |
RefSeq ORF | 528 |
Synonyms | PACAP |
Locus ID | 116 |
UniProt ID | P18509 |
Cytogenetics | 18p11.32 |
Summary | This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400450 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420506 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426082 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400450 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2 |
USD 436.00 |
|
LY420506 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 |
USD 436.00 |
|
LY426082 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 |
USD 436.00 |
|
PH310851 | ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001108) |
USD 3,255.00 |
|
TP310851 | Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, 20 µg |
USD 867.00 |
|
TP321298 | Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review