cGKI (PRKG1) (NM_006258) Human Mass Spec Standard
CAT#: PH320986
PRKG1 MS Standard C13 and N15-labeled recombinant protein (NP_006249)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220986 |
Predicted MW | 77.6 kDa |
Protein Sequence |
>RC220986 representing NM_006258
Red=Cloning site Green=Tags(s) MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQG EPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYG KDSCIIKEGDVGSLVYAMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQ CFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGT VNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKA YEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYL HSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLG ILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQK HKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006249 |
RefSeq Size | 3740 |
RefSeq ORF | 2058 |
Synonyms | AAT8; cGK; cGK 1; cGK1; cGKI; cGKI-alpha; cGKI-BETA; PKG; PKG1; PRKG1B; PRKGR1B |
Locus ID | 5592 |
UniProt ID | Q13976 |
Cytogenetics | 10q11.23-q21.1 |
Summary | Mammals have three different isoforms of cyclic GMP-dependent protein kinase (Ialpha, Ibeta, and II). These PRKG isoforms act as key mediators of the nitric oxide/cGMP signaling pathway and are important components of many signal transduction processes in diverse cell types. This PRKG1 gene on human chromosome 10 encodes the soluble Ialpha and Ibeta isoforms of PRKG by alternative transcript splicing. A separate gene on human chromosome 4, PRKG2, encodes the membrane-bound PRKG isoform II. The PRKG1 proteins play a central role in regulating cardiovascular and neuronal functions in addition to relaxing smooth muscle tone, preventing platelet aggregation, and modulating cell growth. This gene is most strongly expressed in all types of smooth muscle, platelets, cerebellar Purkinje cells, hippocampal neurons, and the lateral amygdala. Isoforms Ialpha and Ibeta have identical cGMP-binding and catalytic domains but differ in their leucine/isoleucine zipper and autoinhibitory sequences and therefore differ in their dimerization substrates and kinase enzyme activity. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Gap junction, Long-term depression, Olfactory transduction, Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416766 | PRKG1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420611 | PRKG1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY416766 | Transient overexpression lysate of protein kinase, cGMP-dependent, type I (PRKG1), transcript variant 2 |
USD 665.00 |
|
LY420611 | Transient overexpression lysate of protein kinase, cGMP-dependent, type I (PRKG1), transcript variant 1 |
USD 665.00 |
|
TP320986 | Recombinant protein of human protein kinase, cGMP-dependent, type I (PRKG1), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review