H2AC21 (NM_175065) Human Mass Spec Standard

CAT#: PH320685

HIST2H2AB MS Standard C13 and N15-labeled recombinant protein (NP_778235)

Product Images

Coomassie blue staining of purified HIST2H2AB protein (Cat# TP320685). The protein was produced from HEK293T cells transfected with HIST2H2AB cDNA clone (Cat# RC220685) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220685
• Predicted MW: 13.8 kDa
• Protein Sequence:
  Sequence Link

  >RC220685 representing NM_175065
  Red=Cloning site Green=Tags(s)
  
  MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA
  ARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGKNK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_778235
• RefSeq Size: 448
• RefSeq ORF: 390
• Synonyms: H2AB; HIST2H2AB
• Locus ID: 317772
• UniProt ID: Q8IUE6
• Cytogenetics: 1q21.2
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq, Aug 2015]
• Protein Pathways: Systemic lupus erythematosus