NFE4 (NM_001085386) Human Mass Spec Standard
CAT#: PH320641
NFE4 MS Standard C13 and N15-labeled recombinant protein (NP_001078855)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220641 |
Predicted MW | 20.33 kDa |
Protein Sequence |
>RC220641 representing NM_001085386
Red=Cloning site Green=Tags(s) LDPVPRRSAAAIALPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQ LLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPRGHAPSAEDPTG SWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001078855 |
RefSeq Size | 967 |
RefSeq ORF | 576 |
Synonyms | NF-E4 |
Locus ID | 58160 |
Cytogenetics | 7q22.1 |
Summary | The erythroid-specific protein encoded by this gene, and the ubiquitous transcription factor CP2, form the stage selector protein (SSP) complex, which is involved in preferential expression of the gamma-globin genes in fetal erythroid cells. Alternate use of an in-frame upstream non-AUG (CUG) translation initiation codon, and a downstream AUG codon, results in two isoforms. While the long isoform (22 kDa) acts as an activator, the short isoform (14 kDa) has been shown to repress gamma-globin gene expression. This gene is located in an intron of the FBXL13 gene on the opposite strand. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421283 | NFE4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY421283 | Transient overexpression lysate of transcription factor NF-E4 (NF-E4) |
USD 436.00 |
|
TP320641 | Recombinant protein of human transcription factor NF-E4 (NF-E4), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review