OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NFE4 (NM_001085386) Human Mass Spec Standard

Be the first to review this product
SKU
PH320641
NFE4 MS Standard C13 and N15-labeled recombinant protein (NP_001078855)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY421283 Transient overexpression lysate of transcription factor NF-E4 (NF-E4) (as WB positive control) 100 ug
$436.00

Other products for "NFE4 or NM_001085386"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220641
Predicted MW 20.33 kDa
Protein Sequence
Protein Sequence
>RC220641 protein sequence
Red=Cloning site Green=Tags(s)

LPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLT
YWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPRGHAPSAEDPTGSWTVSGPCKDHPH
PFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001078855
RefSeq Size 967
RefSeq ORF 537
Synonyms NF-E4
Locus ID 58160
Cytogenetics 7q22.1
Summary The erythroid-specific protein encoded by this gene, and the ubiquitous transcription factor CP2, form the stage selector protein (SSP) complex, which is involved in preferential expression of the gamma-globin genes in fetal erythroid cells. Alternate use of an in-frame upstream non-AUG (CUG) translation initiation codon, and a downstream AUG codon, results in two isoforms. While the long isoform (22 kDa) acts as an activator, the short isoform (14 kDa) has been shown to repress gamma-globin gene expression. This gene is located in an intron of the FBXL13 gene on the opposite strand. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NFE4" proteins (3)
SKU Description Size Price
LC421283 Lyophilized NFE4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421283 Transient overexpression lysate of transcription factor NF-E4 (NF-E4) (as WB positive control) 100 ug
$436.00
TP320641 Recombinant protein of human transcription factor NF-E4 (NF-E4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products