UNC119B (NM_001080533) Human Mass Spec Standard

CAT#: PH319902

UNC119B MS Standard C13 and N15-labeled recombinant protein (NP_001074002)

Product Images

Coomassie blue staining of purified UNC119B protein (Cat# TP319902). The protein was produced from HEK293T cells transfected with UNC119B cDNA clone (Cat# RC219902) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219902
• Predicted MW: 28 kDa
• Protein Sequence:
  Sequence Link

  >RC219902 representing NM_001080533
  Red=Cloning site Green=Tags(s)
  
  MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRP
  EHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFV
  RYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQL
  SEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001074002
• RefSeq Size: 4811
• RefSeq ORF: 753
• Synonyms: POC7B
• Locus ID: 84747
• UniProt ID: A6NIH7, Q69YW6
• Cytogenetics: 12q24.31
• Summary: Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated NPHP3 and plays a key role in localization of NPHP3 to the primary cilium membrane. Does not bind all myristoylated proteins. Probably plays a role in trafficking proteins in photoreceptor cells.[UniProtKB/Swiss-Prot Function]