UNC119B (NM_001080533) Human Mass Spec Standard
CAT#: PH319902
UNC119B MS Standard C13 and N15-labeled recombinant protein (NP_001074002)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219902 |
Predicted MW | 28 kDa |
Protein Sequence |
>RC219902 representing NM_001080533
Red=Cloning site Green=Tags(s) MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRP EHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFV RYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQL SEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001074002 |
RefSeq Size | 4811 |
RefSeq ORF | 753 |
Synonyms | POC7B |
Locus ID | 84747 |
UniProt ID | A6NIH7, Q69YW6 |
Cytogenetics | 12q24.31 |
Summary | Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated NPHP3 and plays a key role in localization of NPHP3 to the primary cilium membrane. Does not bind all myristoylated proteins. Probably plays a role in trafficking proteins in photoreceptor cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421088 | UNC119B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY421088 | Transient overexpression lysate of unc-119 homolog B (C. elegans) (UNC119B) |
USD 436.00 |
|
TP319902 | Recombinant protein of human unc-119 homolog B (C. elegans) (UNC119B), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review