COX8C (NM_182971) Human Mass Spec Standard

CAT#: PH319625

COX8C MS Standard C13 and N15-labeled recombinant protein (NP_892016)

Product Images

Coomassie blue staining of purified COX8C protein (Cat# TP319625). The protein was produced from HEK293T cells transfected with COX8C cDNA clone (Cat# RC219625) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219625
• Predicted MW: 8.1 kDa
• Protein Sequence:
  Sequence Link

  >RC219625 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFR
  RN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_892016
• RefSeq Size: 531
• RefSeq ORF: 216
• Synonyms: COX8-3
• Locus ID: 341947
• UniProt ID: Q7Z4L0
• Cytogenetics: 14q32.12
• Summary: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease