DEFB106A (NM_152251) Human Mass Spec Standard

CAT#: PH319477

DEFB106A MS Standard C13 and N15-labeled recombinant protein (NP_689464)

Product Images

Coomassie blue staining of purified DEFB106A protein (Cat# TP319477). The protein was produced from HEK293T cells transfected with DEFB106A cDNA clone (Cat# RC219477) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219477
• Predicted MW: 7.4 kDa
• Protein Sequence:
  Sequence Link

  >RC219477 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689464
• RefSeq Size: 325
• RefSeq ORF: 195
• Synonyms: BD-6; DEFB-6; DEFB106
• Locus ID: 245909
• UniProt ID: Q8N104
• Cytogenetics: 8p23.1
• Summary: Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. Chromosome 8p23 contains at least two copies of the duplicated beta-defensin cluster. This duplication results in two identical copies of defensin, beta 106, DEFB106A and DEFB106B, in head-to-head orientation. This gene, DEFB106A, represents the more centromeric copy. [provided by RefSeq, Oct 2014]
• Protein Families: Secreted Protein