OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Iduronate 2 sulfatase (IDS) (NM_000202) Human Mass Spec Standard

Be the first to review this product
SKU
PH319187
IDS MS Standard C13 and N15-labeled recombinant protein (NP_000193)
Size:
10 ug
  $3,360.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504277 IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2) 100 ul
$447.00
LY433123 Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "Iduronate 2 sulfatase or NM_000202"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219187
Predicted MW 61.87 kDa
Protein Sequence
Protein Sequence
>RC219187 representing NM_000202
Red=Cloning site Green=Tags(s)

MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVRSPNIDQLASH
SLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVGKVFHPG
ISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLE
KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALN
ISVPYGPIPVDFQRKIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSN
FDVATHVPLIFYVPGRTASLPEAGEKLFPYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPP
RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKPSLKDIKIMGY
SIRTIDYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQLLMP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000193
RefSeq Size 2504
RefSeq ORF 1650
Synonyms ID2S; MPS2; SIDS
Locus ID 3423
UniProt ID P22304
Cytogenetics Xq28
Summary This gene encodes a member of the sulfatase family of proteins. The encoded preproprotein is proteolytically processed to generate two polypeptide chains. This enzyme is involved in the lysosomal degradation of heparan sulfate and dermatan sulfate. Mutations in this gene are associated with the X-linked lysosomal storage disease mucopolysaccharidosis type II, also known as Hunter syndrome. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. provided by RefSeq, Jan 2016
Protein Families Druggable Genome
Protein Pathways Glycosaminoglycan degradation, Lysosome, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Iduronate 2 sulfatase" proteins (7)
SKU Description Size Price
LC416853 Lyophilized IDS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424863 Lyophilized IDS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433123 Lyophilized IDS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416853 Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424863 Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY433123 Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP319187 Recombinant protein of human iduronate 2-sulfatase (IDS), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products