Iduronate 2 sulfatase (IDS) (NM_000202) Human Mass Spec Standard
CAT#: PH319187
IDS MS Standard C13 and N15-labeled recombinant protein (NP_000193)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219187 |
Predicted MW | 61.87 kDa |
Protein Sequence |
>RC219187 representing NM_000202
Red=Cloning site Green=Tags(s) MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVRSPNIDQLASH SLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVGKVFHPG ISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLE KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALN ISVPYGPIPVDFQRKIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSN FDVATHVPLIFYVPGRTASLPEAGEKLFPYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPP RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKPSLKDIKIMGY SIRTIDYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQLLMP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000193 |
RefSeq Size | 2504 |
RefSeq ORF | 1650 |
Synonyms | ID2S; MPS2; SIDS |
Locus ID | 3423 |
UniProt ID | P22304 |
Cytogenetics | Xq28 |
Summary | This gene encodes a member of the sulfatase family of proteins. The encoded preproprotein is proteolytically processed to generate two polypeptide chains. This enzyme is involved in the lysosomal degradation of heparan sulfate and dermatan sulfate. Mutations in this gene are associated with the X-linked lysosomal storage disease mucopolysaccharidosis type II, also known as Hunter syndrome. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416853 | IDS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424863 | IDS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC433123 | IDS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416853 | Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 2 |
USD 436.00 |
|
LY424863 | Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 1 |
USD 665.00 |
|
LY433123 | Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 3 |
USD 436.00 |
|
TP319187 | Recombinant protein of human iduronate 2-sulfatase (IDS), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review