IGFBPL1 (NM_001007563) Human Mass Spec Standard

CAT#: PH319122

IGFBPL1 MS Standard C13 and N15-labeled recombinant protein (NP_001007564)

Product Images

Coomassie blue staining of purified IGFBPL1 protein (Cat# TP319122). The protein was produced from HEK293T cells transfected with IGFBPL1 cDNA clone (Cat# RC219122) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219122
• Predicted MW: 28.8 kDa
• Protein Sequence:
  Sequence Link

  >RC219122 representing NM_001007563
  Red=Cloning site Green=Tags(s)
  
  MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAPAPCPAPGISALDECGCCARCL
  GAEGASCGGRAGGRCGPGLVCASQAAGAAPEGTGLCVCAQRGTVCGSDGRSYPSVCALRLRARHTPRAHP
  GHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVN
  IAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001007564
• RefSeq Size: 1093
• RefSeq ORF: 834
• Synonyms: bA113O24.1; IGFBP-RP4; IGFBPRP4
• Locus ID: 347252
• UniProt ID: Q8WX77
• Cytogenetics: 9p13.1
• Summary: IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors (By similarity). May be a putative tumor suppressor protein.[UniProtKB/Swiss-Prot Function]