SPINK7 (NM_032566) Human Mass Spec Standard

CAT#: PH318867

SPINK7 MS Standard C13 and N15-labeled recombinant protein (NP_115955)

Product Images

Coomassie blue staining of purified SPINK7 protein (Cat# TP318867). The protein was produced from HEK293T cells transfected with SPINK7 cDNA clone (Cat# RC218867) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218867
• Predicted MW: 9.2 kDa
• Protein Sequence:
  Sequence Link

  >RC218867 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTES
  LKSNGRVQFLHDGSC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115955
• RefSeq Size: 566
• RefSeq ORF: 255
• Synonyms: ECG2; ECRG2
• Locus ID: 84651
• UniProt ID: P58062
• Cytogenetics: 5q32
• Summary: Probable serine protease inhibitor.[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein