OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPINK7 (NM_032566) Human Mass Spec Standard

Be the first to review this product
SKU
PH318867
SPINK7 MS Standard C13 and N15-labeled recombinant protein (NP_115955)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410024 Transient overexpression lysate of serine peptidase inhibitor, Kazal type 7 (putative) (SPINK7) (as WB positive control) 100 ug
$436.00

Other products for "SPINK7 or NM_032566"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218867
Predicted MW 9.2 kDa
Protein Sequence
Protein Sequence
>RC218867 protein sequence
Red=Cloning site Green=Tags(s)

MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTES
LKSNGRVQFLHDGSC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115955
RefSeq Size 566
RefSeq ORF 255
Synonyms ECG2; ECRG2
Locus ID 84651
UniProt ID P58062
Cytogenetics 5q32
Summary Probable serine protease inhibitor.UniProtKB/Swiss-Prot Function
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPINK7" proteins (3)
SKU Description Size Price
LC410024 Lyophilized SPINK7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410024 Transient overexpression lysate of serine peptidase inhibitor, Kazal type 7 (putative) (SPINK7) (as WB positive control) 100 ug
$436.00
TP318867 Recombinant protein of human serine peptidase inhibitor, Kazal type 7 (putative) (SPINK7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products