SPINK7 (NM_032566) Human Recombinant Protein
CAT#: TP318867
Recombinant protein of human serine peptidase inhibitor, Kazal type 7 (putative) (SPINK7), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218867 protein sequence
Red=Cloning site Green=Tags(s) MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTES LKSNGRVQFLHDGSC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115955 |
Locus ID | 84651 |
UniProt ID | P58062 |
Cytogenetics | 5q32 |
Refseq Size | 566 |
Refseq ORF | 255 |
Synonyms | ECG2; ECRG2 |
Summary | Probable serine protease inhibitor.[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410024 | SPINK7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410024 | Transient overexpression lysate of serine peptidase inhibitor, Kazal type 7 (putative) (SPINK7) |
USD 436.00 |
|
PH318867 | SPINK7 MS Standard C13 and N15-labeled recombinant protein (NP_115955) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review