PLEKHA2 (NM_021623) Human Mass Spec Standard

CAT#: PH318830

PLEKHA2 MS Standard C13 and N15-labeled recombinant protein (NP_067636)

Product Images

Coomassie blue staining of purified PLEKHA2 protein (Cat# TP318830). The protein was produced from HEK293T cells transfected with PLEKHA2 cDNA clone (Cat# RC218830) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218830
• Predicted MW: 47.1 kDa
• Protein Sequence:
  Sequence Link

  >RC218830 representing NM_021623
  Red=Cloning site Green=Tags(s)
  
  MPYVDRQNRICGFLDIEEHENSGKFLRRYFILDTQANCLLWYMDNPQNLAMGAGAVGALQLTYISKVSIA
  TPKQKPKTPFCFVINALSQRYFLQANDQKDMKDWVEALNQASKITVPKGGGLPMTTEVLKSLAAPPALEK
  KPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILRRSQSYIPTSGCRASTGPPLIKSGYCVKQGN
  VRKSWKRRFFALDDFTICYFKCEQDREPLRTIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYVQA
  DSPEDMHSWIKEIGAAVQALKCHPRETSFSRSISLTRPGSSSLSSGPNSILCRGRPPLEEKKALCKAPSV
  ASSWQPWTPVPQAGEKLLPPGDTSEDSLFTPRPGEGSAPGVLPSSRIRHRSEPQHPKEKPFMFNLDDENI
  RTSDV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067636
• RefSeq Size: 5656
• RefSeq ORF: 1275
• Synonyms: TAPP2
• Locus ID: 59339
• UniProt ID: Q9HB19, A8K727
• Cytogenetics: 8p11.22
• Summary: Binds specifically to phosphatidylinositol 3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. May recruit other proteins to the plasma membrane (By similarity).[UniProtKB/Swiss-Prot Function]