PSORS1C1 (NM_014068) Human Mass Spec Standard
CAT#: PH318532
PSORS1C1 MS Standard C13 and N15-labeled recombinant protein (NP_054787)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218532 |
Predicted MW | 16.4 kDa |
Protein Sequence |
>RC218532 representing NM_014068
Red=Cloning site Green=Tags(s) MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHMEPANHFWHAGDLQAMISKEFH LAATQDDCRKGRTQEDILVPSSHPELFASVLPMAPEEAARLQQPQPLPPPSGIHLSASRTLAPTLLYSSP PSHSPFGLSSLI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_054787 |
RefSeq Size | 861 |
RefSeq ORF | 456 |
Synonyms | C6orf16; SEEK1 |
Locus ID | 170679 |
UniProt ID | Q9UIG5, D2IYL0 |
Cytogenetics | 6p21.33 |
Summary | This gene is one of several genes thought to confer susceptibility to psoriasis and systemic sclerosis, located on chromosome 6 near the major histocompatibility complex (MHC) class I region. [provided by RefSeq, Sep 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415493 | PSORS1C1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415493 | Transient overexpression lysate of psoriasis susceptibility 1 candidate 1 (PSORS1C1) |
USD 436.00 |
|
TP318532 | Recombinant protein of human psoriasis susceptibility 1 candidate 1 (PSORS1C1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review