Monoacylglycerol Lipase (MGLL) (NM_007283) Human Mass Spec Standard
CAT#: PH318358
MGLL MS Standard C13 and N15-labeled recombinant protein (NP_009214)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218358 |
Predicted MW | 34.1 kDa |
Protein Sequence |
>RC218358 representing NM_007283
Red=Cloning site Green=Tags(s) METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAIL TAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLI CRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHV LHKELPEVTNSVFHEINMWVSQRTATAGTASPP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009214 |
RefSeq Size | 4617 |
RefSeq ORF | 939 |
Synonyms | HU-K5; HUK5; MAGL; MGL |
Locus ID | 11343 |
UniProt ID | Q99685, A0A0C4DFN3 |
Cytogenetics | 3q21.3 |
Summary | This gene encodes a serine hydrolase of the AB hydrolase superfamily that catalyzes the conversion of monoacylglycerides to free fatty acids and glycerol. The encoded protein plays a critical role in several physiological processes including pain and nociperception through hydrolysis of the endocannabinoid 2-arachidonoylglycerol. Expression of this gene may play a role in cancer tumorigenesis and metastasis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Glycerolipid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402124 | MGLL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402124 | Transient overexpression lysate of monoglyceride lipase (MGLL), transcript variant 1 |
USD 436.00 |
|
TP318358 | Recombinant protein of human monoglyceride lipase (MGLL), transcript variant 1 |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review