HNF 4 alpha (HNF4A) (NM_178850) Human Mass Spec Standard
CAT#: PH317924
HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849181)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217924 |
Predicted MW | 46.4 kDa |
Protein Sequence |
>RC217924 representing NM_178850
Red=Cloning site Green=Tags(s) MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK HYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR RSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE LPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ IDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ MIEQIQFIKLFGMAKIDNLLQEMLLGGPCQAQEGRGWSGDSPGDRPHTVSSPLSSLASPLCRFGQVA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_849181 |
RefSeq Size | 1600 |
RefSeq ORF | 1251 |
Synonyms | FRTS4; HNF4; HNF4a7; HNF4a8; HNF4a9; HNF4alpha; MODY; MODY1; NR2A1; NR2A21; TCF; TCF-14; TCF14 |
Locus ID | 3172 |
UniProt ID | P41235 |
Cytogenetics | 20q13.12 |
Summary | The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. [provided by RefSeq, Apr 2012] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | Maturity onset diabetes of the young |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400161 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC405861 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC422283 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC422284 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400161 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2 |
USD 665.00 |
|
LY405861 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3 |
USD 665.00 |
|
LY422283 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 |
USD 665.00 |
|
LY422284 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6 |
USD 436.00 |
|
PH311443 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025174) |
USD 3,255.00 |
|
PH314914 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849180) |
USD 3,255.00 |
|
PH316588 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025175) |
USD 3,255.00 |
|
PH317863 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_000448) |
USD 3,255.00 |
|
TP311443 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5, 20 µg |
USD 867.00 |
|
TP314914 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 1, 20 µg |
USD 867.00 |
|
TP316588 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6, 20 µg |
USD 867.00 |
|
TP317863 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2, 20 µg |
USD 867.00 |
|
TP317924 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review