CARHSP1 (NM_001042476) Human Mass Spec Standard

CAT#: PH317744

CARHSP1 MS Standard C13 and N15-labeled recombinant protein (NP_001035941)

Product Images

Coomassie blue staining of purified CARHSP1 protein (Cat# TP317744). The protein was produced from HEK293T cells transfected with CARHSP1 cDNA clone (Cat# RC217744) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217744
• Predicted MW: 15.7 kDa
• Protein Sequence:
  Sequence Link

  >RC217744 representing NM_001042476
  Red=Cloning site Green=Tags(s)
  
  MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVCKCF
  CRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETW
  SGHVISS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035941
• RefSeq Size: 3029
• RefSeq ORF: 441
• Synonyms: CRHSP-24; CRHSP24; CSDC1
• Locus ID: 23589
• UniProt ID: Q9Y2V2
• Cytogenetics: 16p13.2
• Summary: Binds mRNA and regulates the stability of target mRNA. Binds single-stranded DNA (in vitro).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors