TRARG1 (NM_172367) Human Mass Spec Standard

CAT#: PH317523

TUSC5 MS Standard C13 and N15-labeled recombinant protein (NP_758955)

Product Images

Coomassie blue staining of purified TRARG1 protein (Cat# TP317523). The protein was produced from HEK293T cells transfected with TRARG1 cDNA clone (Cat# RC217523) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217523
• Predicted MW: 19.1 kDa
• Protein Sequence:
  Sequence Link

  >RC217523 representing NM_172367
  Red=Cloning site Green=Tags(s)
  
  MAHPVQSEFPSAQEPGSAASLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNGQGLPFKAISEGHL
  EAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVD
  GARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_758955
• RefSeq Size: 3616
• RefSeq ORF: 531
• Synonyms: BEC-1; DSPB1; IFITMD3; LOST1; TUSC5
• Locus ID: 286753
• UniProt ID: Q8IXB3
• Cytogenetics: 17p13.3
• Summary: Regulates insulin-mediated adipose tissue glucose uptake and transport by modulation of SLC2A4 recycling. Not required for SLC2A4 membrane fusion upon an initial stimulus, but rather is necessary for proper protein recycling during prolonged insulin stimulation.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane