OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DCTD (NM_001921) Human Mass Spec Standard

Be the first to review this product
SKU
PH317231
DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001912)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370066 DCTD rabbit polyclonal antibody
100 ul
$310.00
LY419656 Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "DCTD or NM_001921"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217231
Predicted MW 21.01 kDa
Protein Sequence
Protein Sequence
>RC217231 representing NM_001921
Red=Cloning site Green=Tags(s)

MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNG
CSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMS
DKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001912
RefSeq Size 2019
RefSeq ORF 567
Locus ID 1635
UniProt ID P32321
Cytogenetics 4q35.1
Summary The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Pathways Metabolic pathways, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DCTD" proteins (7)
SKU Description Size Price
PH323090 DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001012750) 10 ug
$3,360.00
LC419656 Lyophilized DCTD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422825 Lyophilized DCTD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419656 Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422825 Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP317231 Recombinant protein of human dCMP deaminase (DCTD), transcript variant 2, 20 µg 20 ug
$867.00
TP323090 Recombinant protein of human dCMP deaminase (DCTD), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products