DCTD (NM_001921) Human Mass Spec Standard
CAT#: PH317231
DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001912)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217231 |
Predicted MW | 21.01 kDa |
Protein Sequence |
>RC217231 representing NM_001921
Red=Cloning site Green=Tags(s) MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNG CSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMS DKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001912 |
RefSeq Size | 2019 |
RefSeq ORF | 567 |
Locus ID | 1635 |
UniProt ID | P32321 |
Cytogenetics | 4q35.1 |
Summary | The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419656 | DCTD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422825 | DCTD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419656 | Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 2 |
USD 436.00 |
|
LY422825 | Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 1 |
USD 436.00 |
|
PH323090 | DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001012750) |
USD 3,255.00 |
|
TP317231 | Recombinant protein of human dCMP deaminase (DCTD), transcript variant 2, 20 µg |
USD 867.00 |
|
TP323090 | Recombinant protein of human dCMP deaminase (DCTD), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review