ALLC (NM_018436) Human Mass Spec Standard

CAT#: PH316471

ALLC MS Standard C13 and N15-labeled recombinant protein (NP_060906)

Product Images

Coomassie blue staining of purified ALLC protein (Cat# TP316471). The protein was produced from HEK293T cells transfected with ALLC cDNA clone (Cat# RC216471) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216471
• Predicted MW: 43.4 kDa
• Protein Sequence:
  Sequence Link

  >RC216471 representing NM_018436
  Red=Cloning site Green=Tags(s)
  
  MDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHDWCVLRLGIQG
  VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEEFEAIAELKSDDWSYLVPMTE
  LKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVFGTGQKDWTATDPKEPADLVAIAFGGVCVGF
  SNAKFGHPNNIIGVGGAKSMADGWETARRLDRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTK
  YFEGNAPDSCKVDGCILTTQEEEAVIRQKWILPAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARL
  TIVPDGGVSRLRLRGFPSSICLLRPREKPMLKFSVSFKANP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060906
• RefSeq Size: 1443
• RefSeq ORF: 1173
• Synonyms: ALC
• Locus ID: 55821
• UniProt ID: Q8N6M5, B4DY77
• Cytogenetics: 2p25.3
• Summary: Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.[supplied by OMIM, Nov 2008]
• Protein Pathways: Metabolic pathways, Purine metabolism