SPANXN4 (NM_001009613) Human Mass Spec Standard

CAT#: PH316287

SPANXN4 MS Standard C13 and N15-labeled recombinant protein (NP_001009613)

Product Images

Coomassie blue staining of purified SPANXN4 protein (Cat# TP316287). The protein was produced from HEK293T cells transfected with SPANXN4 cDNA clone (Cat# RC216287) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216287
• Predicted MW: 11.2 kDa
• Protein Sequence:
  Sequence Link

  >RC216287 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEEPTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRNSNQLENN
  QPTESSTDPIKEKGDLDISAGSPQDGGQN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001009613
• RefSeq Size: 431
• RefSeq ORF: 297
• Synonyms: CT11.9
• Locus ID: 441525
• UniProt ID: Q5MJ08
• Cytogenetics: Xq27.3
• Summary: This gene represents one of several duplicated family members that are located on the X chromosome. This gene family encodes proteins that play a role in spermiogenesis. These proteins represent a specific subgroup of cancer/testis-associated antigens, and they may be candidates for tumor vaccines. This family member belongs to a subgroup of related genes that are present in all primates and rats and mice, and thus, it represents one of the ancestral family members. [provided by RefSeq, Sep 2009]